DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG17477

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:231 Identity:95/231 - (41%)
Similarity:142/231 - (61%) Gaps:5/231 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCME-WPIQYLKIVTGTVDYTRPG 105
            ::||.::..|.||||||:....|.|:|||:||:.:||:||.||:: :|...|::.|||:.|..||
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91

  Fly   106 AEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTK 170
            |.|..|...:||::|.|.|.|||.|:|..:.|.::.|||.::|.: ...|:...:|..|||||..
  Fly    92 AVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPT-SPFPRGASELVFTGWGSQS 155

  Fly   171 TWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEG--HVCTFTQEGEGSCHGDSGGPLVDANQTL 233
            ..|...:|||::...:::...|:|.:.....|..|  |:|.:.|...|:||||||||||... ||
  Fly   156 AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQG-TL 219

  Fly   234 VGVVNWGEACAIGYPDVFGSVAYYHDWIEQMMTDAG 269
            ||::|:...||.|.||:|.::.||.||:.|.|:..|
  Fly   220 VGILNFFVPCAQGVPDIFMNIMYYRDWMRQTMSGNG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 91/221 (41%)
Tryp_SPc 42..263 CDD:238113 92/223 (41%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 92/224 (41%)
Tryp_SPc 27..246 CDD:214473 90/220 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.