DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG9649

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:248 Identity:67/248 - (27%)
Similarity:118/248 - (47%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GVDSPTGFAPYQVSIMNTFGEHV-------CGGSIIAPQWILTAAHCMEWPIQYL----KIVT-- 96
            |::...|..|:..::.    |||       |||::|:.:.:::||||..:..:.|    .||:  
  Fly   260 GIEVERGQLPWMAALF----EHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLG 320

  Fly    97 -GTVDYTRPGAEYLVDGSKIHCSHDKPAYHN-DIALIHTAKPIVYDDLTQPIKLASKGSLPKV-- 157
             .::|....||...|....||..::...|.: |:||:..:..:...|..:||.|.::..|.::  
  Fly   321 RNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPS 385

  Fly   158 GDKLTLTGWGSTKTWGRYSTQLQKI-DLNYIDHDNCQSRV--RNANWLSEGHVCTFTQEGEGSCH 219
            |.|..:.|||..:. |..:|:|.|: |.:.|....|:..:  .||.:::...:|....:..|.|.
  Fly   386 GHKSYVAGWGEDEK-GNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCS 449

  Fly   220 GDSGGPLVDANQ---TLVGVVNWGE----ACAIGYPDVFGSVAYYHDWIEQMM 265
            |||||.|:...|   .|.|||:.|:    .|.:..|.::..||.:.:|:...|
  Fly   450 GDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWLLSSM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 65/242 (27%)
Tryp_SPc 42..263 CDD:238113 66/244 (27%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 65/242 (27%)
Tryp_SPc 259..497 CDD:214473 65/241 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.