DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG8870

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:229 Identity:64/229 - (27%)
Similarity:97/229 - (42%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGGSIIAPQWILTAAHCMEWP-IQY---LK----------------IVTGTVDYTRPGAEYLVDG 112
            ||||:|...::||||||:|:| :.|   ||                ||.|...|.....|..||.
  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181

  Fly   113 SKIHCSHDK-PAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYS 176
            ...|...:: ....|||||:....|:.|....|||.|.....|.....|...:||..... |..|
  Fly   182 IITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQ-GIAS 245

  Fly   177 TQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVD----ANQTL---V 234
            ..|.:..:.....|.|:|   |.::.....:|....:|..:..|||||||::    ...||   .
  Fly   246 EVLLRSFIAERHPDVCKS---NYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAA 307

  Fly   235 GVVNWGE-ACAIG--YPDVFGSVAYYHDWIEQMM 265
            |::::|: .|.:.  .|..:...:|:.:||:..:
  Fly   308 GIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 62/223 (28%)
Tryp_SPc 42..263 CDD:238113 64/225 (28%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 64/226 (28%)
Tryp_SPc 93..337 CDD:214473 62/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.