DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG16749

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:248 Identity:82/248 - (33%)
Similarity:122/248 - (49%) Gaps:25/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LGHVKPET-RVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHC------MEWPIQ 90
            :.|..|:. ||:.|.||.....|:.:|:..:.|.|.||||||:.|:::|||||      .:..:|
  Fly    20 ISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQ 84

  Fly    91 YLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYH---NDIALIHTAKPIVYDDLT-QPIKLASK 151
            |     |.......|.. :|...||....|...|:   |||:|:...:|..:|.:| .|:||...
  Fly    85 Y-----GVTKINATGPN-VVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPEL 143

  Fly   152 G-SLPK--VGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQE 213
            . :.|:  .|.:..|.|||...|.|...:.||:::|.....:.|..| .........|:|....|
  Fly   144 AFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTER-HGGRTDPRYHICGGVDE 207

  Fly   214 -GEGSCHGDSGGPLVDANQTLVGVVNWG-EACAIG-YPDVFGSVAYYHDWIEQ 263
             |:|.|.|||||||: .|...||:|:|. :.|.:. ||.|:..|:.|.|||::
  Fly   208 GGKGQCSGDSGGPLI-YNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 78/235 (33%)
Tryp_SPc 42..263 CDD:238113 79/236 (33%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 78/235 (33%)
Tryp_SPc 30..259 CDD:238113 79/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.