DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:247 Identity:77/247 - (31%)
Similarity:125/247 - (50%) Gaps:37/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCM-------EWPIQY 91
            ||     :|.||.|:..|..|:|.|:... ..|.||.::|:..|::|||||.       :|.:.:
  Rat   184 GH-----KVAGGQDAEEGEWPWQASLQQN-NVHRCGATLISNSWLITAAHCFVRSANPKDWKVSF 242

  Fly    92 LKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPK 156
            ..::      ::|.|:..|....||.::..||::||||::..:.|::|::..:      :..||:
  Rat   243 GFLL------SKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIR------RACLPE 295

  Fly   157 VGDK------LTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGE 215
            ...|      :.:||||:.|:.|.....|||..:..||:..|.|.......::.|.:|....||.
  Rat   296 ATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGR 360

  Fly   216 -GSCHGDSGGPLVDANQT----LVGVVNWGEACAI-GYPDVFGSVAYYHDWI 261
             .:|.||||||||..:..    |.|:|:||:.||: ..|.|:..|.:|.|||
  Rat   361 VDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 73/238 (31%)
Tryp_SPc 42..263 CDD:238113 75/239 (31%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 73/238 (31%)
Tryp_SPc 187..415 CDD:238113 75/239 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.