DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and MP1

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:267 Identity:77/267 - (28%)
Similarity:123/267 - (46%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVIGGVDSPTGFAPYQVSIM-----NTFGEHVCGGSIIAPQWILTAAHCM-----EWPIQYLKI- 94
            ||:||.::.....|:...|.     |..|.| ||||:|..:::||||||:     :|.:..::: 
  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHH-CGGSLINHRYVLTAAHCVSAIPSDWELTGVRLG 200

  Fly    95 -------------VTGTVDYTRPGAEYLVDGSKIHCSHDKPAYH-------NDIALIHTAKPIVY 139
                         ..|..|...|..:|.|:....|     |.|.       |||||:.....:.|
  Fly   201 EWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPH-----PQYPGNSRDQLNDIALLRLRDEVQY 260

  Fly   140 DDLTQPI---KLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQ-KIDLNYIDHDNCQSR-VRNA 199
            .|...|:   .|||:.:...:|.|:.:.|||.|:|  .:::.:: |.:|:.:....|..| ....
  Fly   261 SDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTET--NFTSNIKLKAELDTVPTSECNQRYATQR 323

  Fly   200 NWLSEGHVCTFTQEGEGSCHGDSGGPLV-------DANQTLVGVVNWGEA-CAI-GYPDVFGSVA 255
            ..::...:|....||..||.|||||||:       ::|..:.|||::|.. |.: |:|.|:..|.
  Fly   324 RTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVE 388

  Fly   256 YYHDWIE 262
            .|.:|||
  Fly   389 AYLNWIE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 74/264 (28%)
Tryp_SPc 42..263 CDD:238113 76/266 (29%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 74/264 (28%)
Tryp_SPc 138..397 CDD:238113 76/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.