DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG7542

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:278 Identity:79/278 - (28%)
Similarity:133/278 - (47%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE 65
            ||.||.:   :::..|:|..:           |..|:|  .:..|..:..|..|||..:..:||.
  Fly     2 MKLLVCV---LLVGSCTAVPL-----------LTDVEP--YITNGEPAEVGQFPYQAGLNVSFGN 50

  Fly    66 HV--CGGSIIAPQWILTAAHCMEWPIQYLKIVTGTV---DYTRPGAEYLV---DGSKIHCSHDKP 122
            ..  |||::|:..||:||||||: ..:.:.:..|.:   |.:..|.|.::   .|..:|.::...
  Fly    51 WSTWCGGTLISHYWIITAAHCMD-GAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMAS 114

  Fly   123 AYHNDIALIHTAKPIVYDDLTQPIKLASK--GSLPKVGD-KLTLTGWG-STKTWGRYSTQLQKID 183
            ...|||:||.....:.:.|..:...|..:  |..|.... :...:||| .:......|..|:.::
  Fly   115 TVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVE 179

  Fly   184 LNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV--DANQT-LVGVVNWGEA--C 243
            :..:.|..|  |:..:..:||..:|..|..|:.:||||||||||  ..|.: |:|..::|.:  |
  Fly   180 MPIMPHSLC--RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGC 242

  Fly   244 AIGYPDVFGSVAYYHDWI 261
            .:|:|.||..::.|.|||
  Fly   243 QVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 68/236 (29%)
Tryp_SPc 42..263 CDD:238113 70/237 (30%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 70/237 (30%)
Tryp_SPc 27..260 CDD:214473 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436880
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.