DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG4914

DIOPT Version :10

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:55 Identity:17/55 - (30%)
Similarity:26/55 - (47%) Gaps:20/55 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 ASYIAKLVKESQKNDVITTSSGNDNPFMKAAGNSATADASTISSAYNIFYFDQTS 314
            :|.||:...|.: |.::|.    |:|       .:|:|        ||||:|.||
  Fly     5 SSTIARKTWELE-NSILTV----DSP-------DSTSD--------NIFYYDDTS 39

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 42..263 CDD:238113 1/2 (50%)
CG4914NP_648711.1 Tryp_SPc 128..363 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.