DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and cfd

DIOPT Version :10

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_989320.1 Gene:cfd / 394945 XenbaseID:XB-GENE-973605 Length:265 Species:Xenopus tropicalis


Alignment Length:38 Identity:9/38 - (23%)
Similarity:18/38 - (47%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   786 DNDTSEVASIATSIEDEAIYDLSEMPSDDPFGIPEYAD 823
            |.|...:..:.|:|....::. |.:|:|.....|:.|:
 Frog    36 DRDYRALCDVGTAISCSRVFS-SRLPADTLGLCPDAAE 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 42..263 CDD:238113
cfdNP_989320.1 Tryp_SPc 27..251 CDD:238113 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.