DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG18179

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:244 Identity:75/244 - (30%)
Similarity:108/244 - (44%) Gaps:41/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETRVIGGVDSPTGFAPYQVSIM-NTFGEH---VCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTV 99
            |.|::.|..:|.|.|||.|.:: .|.|.:   |..|:|||..||||||||:            |.
  Fly    37 EGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCL------------TT 89

  Fly   100 DYT--RPGAEYLVDGS-KIHCSHDKPAYH--------NDIALIHTAKPIVYDDLTQPIKLASKGS 153
            ||.  ..|:.:..:|: :.....|....|        .||.||.|.. :.:.||...:.|.   |
  Fly    90 DYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGRDIGLIRTPS-VGFTDLINKVALP---S 150

  Fly   154 LPKVGDKLTLT-----GWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQE 213
            ..:..|:...|     |||.... |..:..||.:|:..|.:..|:   ::...::...:||...:
  Fly   151 FSEESDRFVDTWCVACGWGGMDN-GNLADWLQCMDVQIISNSECE---QSYGTVASTDMCTRRTD 211

  Fly   214 GEGSCHGDSGGPLV-DANQTLVGVVNWGEACAIGYPDVFGSVAYYHDWI 261
            |:.||.|||||||| ..|..||||:.:|.......|..:..|..|..||
  Fly   212 GKSSCGGDSGGPLVTHDNARLVGVITFGSVDCHSGPSGYTRVTDYLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 72/240 (30%)
Tryp_SPc 42..263 CDD:238113 73/241 (30%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 72/240 (30%)
Tryp_SPc 40..263 CDD:238113 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436796
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.