DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG8329

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:282 Identity:87/282 - (30%)
Similarity:123/282 - (43%) Gaps:52/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KCLVLISVLVILSQCSAKSVKIHR-RHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE 65
            |.|||: :|.:.:.|:      || |::..||.|  .|:..::.|..:..|.|||.|.:....|.
  Fly     3 KKLVLL-LLFVATVCA------HRNRNRTAHHGG--GPKDIIVNGYPAYEGKAPYAVGLRMNNGA 58

  Fly    66 HVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDK-----PAYH 125
             |.|||:|...|:||||||       |...:.|:.|   |:....:|...|..:..     |.|.
  Fly    59 -VGGGSVIGNNWVLTAAHC-------LTTDSVTIHY---GSNRAWNGQLQHTVNKNNFFRHPGYP 112

  Fly   126 N----DIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDK--------LTLTGWGSTKTWGRYSTQ 178
            |    ||.||.|.    |...|   .|.:|.||||...|        ....|||.... |..:..
  Fly   113 NSAGHDIGLIRTP----YVSFT---NLINKVSLPKFSQKGERFENWWCVACGWGGMAN-GGLADW 169

  Fly   179 LQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV-DANQTLVGVVNWGE- 241
            ||.:|:..|.:..|   .|:...::...:||...:|:..|.|||||.|| ..|...|||:.:.. 
  Fly   170 LQCMDVQVISNGEC---ARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFASI 231

  Fly   242 ACAIGYPDVFGSVAYYHDWIEQ 263
            .|..| |..:..|:.:.|||.:
  Fly   232 GCKSG-PSGYTRVSDHLDWIRE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 72/238 (30%)
Tryp_SPc 42..263 CDD:238113 74/239 (31%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 74/241 (31%)
Tryp_SPc 35..250 CDD:214473 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.