DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and sphinx2

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:295 Identity:66/295 - (22%)
Similarity:110/295 - (37%) Gaps:78/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNT--- 62
            ||.:|.:.||.:......|:                |...|:.||..:......|.|.|:..   
  Fly     1 MKLVVALLVLSLTFSVCEKN----------------KLSPRITGGYRAKPYTIIYLVGIVYAKSP 49

  Fly    63 -----FGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKP 122
                 ||    .|:||:.|||||....:.:                   :|:    :.|....:.
  Fly    50 LSSLKFG----AGTIISNQWILTVKEVLIF-------------------KYI----EAHFGSKRA 87

  Fly   123 AYHNDIALIHTAKPIVYDDLTQPIKLA-----------SKGSLPK--------VGDKLTLTGWGS 168
            .:..||..|:......:.|.|:.|.|.           |:..:|.        ||:...:.|||:
  Fly    88 FWGYDILRIYRENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGT 152

  Fly   169 TKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV--DANQ 231
            .|...|..|.::.:::..:::..|........|.   .:||..:..:|.|.||.||.:|  ..|.
  Fly   153 DKRKVRLPTWMRCVEVEVMNNTECAKYHTPLKWY---EMCTSGEGFKGVCEGDMGGAVVTMGPNP 214

  Fly   232 TLVGVVNW--GEACAIGYPDVFGSVAYYHDWIEQM 264
            |.:|:: |  ...|:||||.|...|:.:..||:.:
  Fly   215 TFIGII-WLMPTNCSIGYPSVHIRVSDHIKWIKHV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 57/250 (23%)
Tryp_SPc 42..263 CDD:238113 58/251 (23%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 57/250 (23%)
Tryp_SPc 26..248 CDD:304450 58/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.