DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG10469

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:284 Identity:85/284 - (29%)
Similarity:132/284 - (46%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTF----- 63
            ::|..||::               |.:...|......|::.|..:.....||||.::..|     
  Fly     1 MILQLVLIV---------------QFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKD 50

  Fly    64 GEHVCGGSIIAPQWILTAAHCMEWPIQYL-KIV--TGTVDYTRPGAEYLVDGSK--IHCSHDKPA 123
            ..::|||:|::.:||:|||||::.|...| |::  .|.|. :....|.:|:.|.  :|...|:..
  Fly    51 EPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVK-SFDDKEIVVNRSYTIVHKKFDRKT 114

  Fly   124 YHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYID 188
            ..||||||...|.:.::...||.||.| ......|.|..::|||.| |....|..||.|....|.
  Fly   115 VTNDIALIKLPKKLTFNKYIQPAKLPS-AKKTYTGRKAIISGWGLT-TKQLPSQVLQYIRAPIIS 177

  Fly   189 HDNCQSRVRNANW-----------LSEGHVCTFTQEGEGSCHGDSGGPLV--DANQTLVGVVNWG 240
            :..|:.:     |           :..|.:|..:::|. .|.||||||:|  |.::||||:|:.|
  Fly   178 NKECERQ-----WNKQLGGKSKKVVHNGFICIDSKKGL-PCRGDSGGPMVLDDGSRTLVGIVSHG 236

  Fly   241 --EACAIGYPDVFGSVAYYHDWIE 262
              ..|.:..|||...|:.|..||:
  Fly   237 FDGECKLKLPDVSTRVSSYLKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 78/244 (32%)
Tryp_SPc 42..263 CDD:238113 79/246 (32%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 78/244 (32%)
Tryp_SPc 24..260 CDD:238113 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436904
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.