DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:286 Identity:84/286 - (29%)
Similarity:134/286 - (46%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSI---MNT 62
            ||.|:::::.|..|......:: ||..:: ..:|.:  ..|:.||.::..|..||||.:   ::.
  Fly     1 MKFLIILALAVAASAFPEPELR-HRSREM-PVVGDI--GGRITGGSNAAVGQFPYQVGLSLKLSA 61

  Fly    63 FGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSK--IHCSHDKPAYH 125
            .....||||:|...|:||||||.: .:|.:.:..|....|.....:.|..|.  ||...:.....
  Fly    62 LSSAWCGGSLIGSTWVLTAAHCTD-GVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLR 125

  Fly   126 NDIALIHTAKPIVYDDLTQPIKLASKGSLPK--------VGDKLTLTGWGSTK-TWGRYSTQLQK 181
            |||:||..       ..|......|...||.        |||....:|||.|. |....:|.||.
  Fly   126 NDISLIKI-------PATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQY 183

  Fly   182 IDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV-DANQTLVGVVNWGEA--C 243
            :||..|.:..| ::....:.:::..:|..|.:.:.:|:|||||||| .::...:|:.::|.:  |
  Fly   184 VDLTVITNTKC-AQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGC 247

  Fly   244 AIGYPDVFGSVAYYHDWIEQMMTDAG 269
            ..|||..|..|..|.|||:   |:.|
  Fly   248 EKGYPAAFTRVTSYLDWIK---TNTG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 72/236 (31%)
Tryp_SPc 42..263 CDD:238113 73/237 (31%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 72/236 (31%)
Tryp_SPc 38..268 CDD:238113 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436868
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.