DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG15873

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:314 Identity:78/314 - (24%)
Similarity:126/314 - (40%) Gaps:81/314 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPET--RVIGGVDSPTGFAP-------YQ 56
            |:.|.:...|::.:..|...:.:         :|.:..||  .:|.|     |:.|       :.
  Fly     1 MQILTVFLGLILSTSLSDADLGV---------IGDISDETFEMLISG-----GYKPKSNRLSRHV 51

  Fly    57 VSI------MNTFGEHVCGGSIIAPQWILTAAHCMEWPIQY--------LKIVTGTVDYTRPGAE 107
            |||      .:....|.|.|.:::.:.:||||||:  ..:|        :::|.|.:  ||. |.
  Fly    52 VSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCL--TDRYKASMNPRGIRVVFGHI--TRL-AV 111

  Fly   108 Y------LVDGSKIHCSHDKPAYH----NDIALIHTAKPIVYDDLTQPIKLASKGSLPKV----- 157
            |      .||...:|     |.|.    ||:|::.         |::.::.::...||.:     
  Fly   112 YDESDFRSVDRLVVH-----PEYERYKKNDLAILR---------LSERVQSSNHDVLPLLMRKTA 162

  Fly   158 ----GDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSC 218
                ||.....|||.....|.||.:|..:|:.......||...  ..:.::.:|||.......:|
  Fly   163 NVTYGDTCITLGWGQIYQHGPYSNELVYLDVILRPPSLCQKHY--DTFTADHNVCTEPVGESMNC 225

  Fly   219 HGDSGGPLVDANQTLVGVVNWGEACAIGYPDVFGSVAYYHDWI---EQMMTDAG 269
            .||.||||: ....|.|::.....||.|....|.|..||.|||   .|.::|.|
  Fly   226 AGDMGGPLL-CKGALFGLIGGHMGCAGGKAMKFLSFLYYKDWILLTIQSLSDCG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 66/259 (25%)
Tryp_SPc 42..263 CDD:238113 68/263 (26%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 58/240 (24%)
Tryp_SPc 59..250 CDD:238113 51/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436952
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.