DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG13527

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:304 Identity:82/304 - (26%)
Similarity:133/304 - (43%) Gaps:82/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KC---LVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNT- 62
            ||   .:||:|:||||..       ||..:|:....|          .|.....|.|.|||.:. 
  Fly     4 KCQYVAILITVMVILSGA-------HRMKRLSSPKFH----------GDETLELAKYVVSIRSRT 51

  Fly    63 ----FGE-HVCGGSIIAPQWILTAAHC------MEWPIQYLKIVTGT---VDYTRPGAEYLVDGS 113
                ||: |.|||.:::.||::|||||      :.:..::|.:|.|:   :.|| ||        
  Fly    52 PNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYT-PG-------- 107

  Fly   114 KIHCSHDKPAY-------HN--DIALIHTAKPIVYDD-----LTQPIKLASKGSLPKVGDKLTLT 164
            |..||.....|       ||  ::||:...:.:..:|     |..|      ...||:|.:.|:.
  Fly   108 KSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHLP------KEAPKIGIRHTVL 166

  Fly   165 GWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVC----TFTQEGEGSCHGDSGGP 225
            |||.....|..:..:.::|:..:|:..|::..|:   ..:|.:|    .:|.:.| .|.||.|.|
  Fly   167 GWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRH---YGDGMMCAGNNNWTIDAE-PCSGDIGSP 227

  Fly   226 LVDANQTLVGVVNWGEACAIG-----YPDVFGSVAYY----HDW 260
            |: :.:.:||:|.:...|...     |.|||..:.:.    :||
  Fly   228 LL-SGKVVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTAYDW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 69/262 (26%)
Tryp_SPc 42..263 CDD:238113 69/261 (26%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 65/242 (27%)
Tryp_SPc 43..263 CDD:214473 65/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.