DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG8299

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:278 Identity:91/278 - (32%)
Similarity:140/278 - (50%) Gaps:48/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSI-MNTFG-EH 66
            |.|::.|.::....:.|:..|                 ::||..:.....|||||: :.|:. .|
  Fly     7 LFLLAALGVVILTDSASISTH-----------------IVGGDQADIADFPYQVSVRLETYMLLH 54

  Fly    67 VCGGSIIAPQWILTAAHCMEWP-IQYLKIVTG---TVDYTRPGAEYLVDGSKI--HCSHDKPAYH 125
            :|||||.||:.::|||||::.. ..|::||.|   ..|....|    |..||:  |..::|..|.
  Fly    55 ICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIADLEEQG----VKVSKLIPHAGYNKKTYV 115

  Fly   126 NDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGS-TKTWGRYSTQLQKIDLNYIDH 189
            |||.||.|.:|:.|..|.|||.:|.:.  |..|.:..::|||. .:........|:.::|..|:.
  Fly   116 NDIGLIITREPLEYSALVQPIAVALEA--PPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEK 178

  Fly   190 DNCQSRVRNANWLSEGHVCT-------FTQEGEGSCHGDSGGPL-VDANQTLVGVVNWGEACA-I 245
            ..|     .|.:|::.:..|       :.:.|:.:|:||||||| ||.  .|||||:||..|. .
  Fly   179 STC-----GAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDG--VLVGVVSWGVGCGRE 236

  Fly   246 GYPDVFGSVAYYHDWIEQ 263
            |:|.|:.||..:.||||:
  Fly   237 GFPGVYTSVNSHIDWIEE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 83/237 (35%)
Tryp_SPc 42..263 CDD:238113 85/238 (36%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/254 (33%)
Tryp_SPc 28..255 CDD:238113 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.