DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and etaTry

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:277 Identity:92/277 - (33%)
Similarity:141/277 - (50%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE---- 65
            |::.:|.:|......:|.             .:.:.|::||.|:.:.:..|.|.:......    
  Fly     4 VILRILAVLFLLGIYAVS-------------AQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSY 55

  Fly    66 -HVCGGSIIAPQWILTAAHCM-EWPIQYLKIVTGTVDYTRPGAE-YLVDGSKI--HCSHDKPAYH 125
             ..|||.|:....|.|||||: ....:...:|.|  |.:|.|.. .:|..||:  |..::.....
  Fly    56 AQTCGGCILDAVTIATAAHCVYNREAENFLVVAG--DDSRGGMNGVVVRVSKLIPHELYNSSTMD 118

  Fly   126 NDIALIHTAKPIVYDDLT--QPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYID 188
            |||||:....|:..|..:  :.|::||:  .|.||.:.|::|||.||..|..|.|||::.:..:|
  Fly   119 NDIALVVVDPPLPLDSFSTMEAIEIASE--QPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVD 181

  Fly   189 HDNCQSRVRNANW--LSEGHVCT-FTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPD 249
            .:.||...   .|  :|||.:|. .::.|:.:|.||||||||.||: |.|:|:|||.|| ..||.
  Fly   182 SEKCQEAY---YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANK-LAGIVSWGEGCARPNYPG 242

  Fly   250 VFGSVAYYHDWIEQMMT 266
            |:.:||||.|||.:..|
  Fly   243 VYANVAYYKDWIAKQRT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 85/234 (36%)
Tryp_SPc 42..263 CDD:238113 86/235 (37%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 85/234 (36%)
Tryp_SPc 28..257 CDD:238113 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.