DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG12133

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:276 Identity:66/276 - (23%)
Similarity:118/276 - (42%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GHVKPETRVIGGVDSPTGFAP------YQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYL 92
            |...|.:.::||:::.:...|      |:..........:|.||:||.:::||||||:.....|:
  Fly    54 GQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYV 118

  Fly    93 -KIVTGTVDYTR-PGAEYLVDGSKI----HCSHD-------------KPAYHNDIALIHTAKPIV 138
             ::..|..|... |...:|.:|:||    |...|             ...::|||||:.....:.
  Fly   119 ARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVK 183

  Fly   139 YDDLTQPI--------KLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSR 195
            |....:||        ..:|..:.|     ..:.|||.:....: ||.|::..::.:..|.|.:|
  Fly   184 YTLQIRPICIWPGIELSTSSFKNFP-----FQIAGWGDSGLQQK-STVLRQGTISGMSPDECLNR 242

  Fly   196 VRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV-------DANQTLVGVVNWGEA-CAIGY-PDVF 251
            ........:..:|....:|..:..||||.||:       |....|.|:.::|.. .:.|| |.|:
  Fly   243 YPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVY 307

  Fly   252 GSVAYYHDWIEQMMTD 267
            ...:.|::||::.:.|
  Fly   308 TKTSSYYEWIKKKIND 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 61/261 (23%)
Tryp_SPc 42..263 CDD:238113 63/262 (24%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 63/263 (24%)
Tryp_SPc 62..317 CDD:214473 61/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.