DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG17572

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:228 Identity:60/228 - (26%)
Similarity:97/228 - (42%) Gaps:43/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGGSIIAPQWILTAAHCMEWPI---QYLKIVTGTVD-----------YTRP-GAEYLVDGSKIHC 117
            |.|::||.:.|||||||.....   :...:..|..|           :..| ...:.:....:|.
  Fly   160 CAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHP 224

  Fly   118 SHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKI 182
            .:.:..||:||||:....|:.|...||||.|....:...||.:.|:.|||...|......::..:
  Fly   225 DYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHL 289

  Fly   183 DLNYIDHDNCQSRVRN--------------ANWLSEGHVCTFTQEGEGSCHGDSGGPL-VDANQ- 231
            |:.....|.|   :||              ..|:..|      .||:..|.|..|.|| :..|. 
  Fly   290 DVPLTSWDLC---LRNYGSTGALESPNSIEGQWMCAG------GEGKDVCQGFGGAPLFIQENGI 345

  Fly   232 -TLVGVVNWG-EAC-AIGYPDVFGSVAYYHDWI 261
             :.:|::::| :.| .:..|.|:.|||::.:||
  Fly   346 FSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 58/226 (26%)
Tryp_SPc 42..263 CDD:238113 60/228 (26%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 60/228 (26%)
Tryp_SPc 138..378 CDD:214473 58/226 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.