DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG4650

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:219 Identity:54/219 - (24%)
Similarity:80/219 - (36%) Gaps:56/219 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HVCGGSIIAPQWILTAAHCMEWPIQYLKIV---TGTVDYTRPG-AEYLVDGSKIHCSHDKPAYHN 126
            :||||::|..:.:||||||.....|.:..:   .||.|..... :||.|..:.||..::.....|
  Fly    55 YVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSAN 119

  Fly   127 DIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKI--------- 182
            |||::..|..||:....:||               .:..|   ..|.:|...:|.:         
  Fly   120 DIAILGLATDIVFSKTIRPI---------------CIVWW---TIWRKYIDNIQVLSGAQWGLPN 166

  Fly   183 DLNYIDHDNCQS-RVRNANWLS--EGHVCTFTQEGEGSCHGDSGGPLVDAN-------------- 230
            |.|..|...... |.:.||..|  .|.....:|    .|.|||...|.:.:              
  Fly   167 DRNESDAFRITDIRRQPANMCSTLNGTAILSSQ----FCAGDSDSKLCNVDFSSPLGAIITFKNI 227

  Fly   231 --QTLVGVVNWGEAC--AIGYPDV 250
              ..|:|:....:.|  |..|.||
  Fly   228 QRYVLIGIATTNQKCKRASVYTDV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 54/219 (25%)
Tryp_SPc 42..263 CDD:238113 54/219 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 54/219 (25%)
Tryp_SPc 33..258 CDD:304450 54/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.