DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and OVCH1

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_024304736.1 Gene:OVCH1 / 341350 HGNCID:23080 Length:1120 Species:Homo sapiens


Alignment Length:243 Identity:78/243 - (32%)
Similarity:127/243 - (52%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEW---PIQYLKIVTGTVDYT 102
            |:.||.::.....|:||. :...|::.|||:||.|.||||||||::.   |:.: .|:.|..|..
Human   609 RIAGGEEACPHCWPWQVG-LRFLGDYQCGGAIINPVWILTAAHCVQLKNNPLSW-TIIAGDHDRN 671

  Fly   103 RPGAEYLVDGSK---IHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKL--- 161
            ...:...|..:|   :|...:..:|.:|||||..:.|:.|:.:.:|:      .||...:.|   
Human   672 LKESTEQVRRAKHIIVHEDFNTLSYDSDIALIQLSSPLEYNSVVRPV------CLPHSAEPLFSS 730

  Fly   162 ---TLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNAN--WLSEGHVCT-FTQEGEGS-CH 219
               .:|||||....|..:::||:|.::.::.:.|:....:|:  .::|..:|. |...||.. |.
Human   731 EICAVTGWGSISADGGLASRLQQIQVHVLEREVCEHTYYSAHPGGITEKMICAGFAASGEKDFCQ 795

  Fly   220 GDSGGPLVDANQ----TLVGVVNWGEACAIGY-PDVFGSVAYYHDWIE 262
            ||||||||..::    .|.|:|:||..|...: |.||..|..:.|||:
Human   796 GDSGGPLVCRHENGPFVLYGIVSWGAGCVQPWKPGVFARVMIFLDWIQ 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 76/240 (32%)
Tryp_SPc 42..263 CDD:238113 77/242 (32%)
OVCH1XP_024304736.1 Tryp_SPc 58..294 CDD:238113
CUB 336..444 CDD:238001
CUB 454..565 CDD:238001
Tryp_SPc 610..845 CDD:238113 77/242 (32%)
CUB 881..978 CDD:238001
CUB 1017..1119 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.