DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and PRSS38

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:284 Identity:87/284 - (30%)
Similarity:142/284 - (50%) Gaps:39/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHL--------GHVKPETRVIGGVDSPTGFAPYQVSIM 60
            |:|:.::|...:.:|   .:||:.: |..:        |....|.:::|||.:|....|:|||: 
Human    18 LLLLLLVVAPPRVAA---LVHRQPE-NQGISLTGSVACGRPSMEGKILGGVPAPERKWPWQVSV- 77

  Fly    61 NTFGEHVCGGSIIAPQWILTAAHCM--EWPIQYLKIVTGTVDYTRPGAE---YLVDGSKIHCSHD 120
            :..|.|||||||:...|:|:||||.  :..|:...:..|.|:....|..   |.|:...:|.:::
Human    78 HYAGLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMYVGLVNLRVAGNHTQWYEVNRVILHPTYE 142

  Fly   121 KPAYH---NDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLT-----LTGWGSTKTWGRYST 177
              .||   .|:||:.....||:.:...|:.||:    |:|  .||     .||||.....|..|.
Human   143 --MYHPIGGDVALVQLKTRIVFSESVLPVCLAT----PEV--NLTSANCWATGWGLVSKQGETSD 199

  Fly   178 QLQKIDLNYIDHDNCQSRVRNANWLSEGHVCT-FTQEGEGSCHGDSGGPLV-DANQT--LVGVVN 238
            :||::.|..|....|.....:.:::....:|. .....:..|.|||||||| :.|::  .:|:|:
Human   200 ELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQIGIVS 264

  Fly   239 WGEACAIG-YPDVFGSVAYYHDWI 261
            ||..|:.. ||.|:.||:|:..||
Human   265 WGRGCSNPLYPGVYASVSYFSKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 76/237 (32%)
Tryp_SPc 42..263 CDD:238113 78/238 (33%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.