DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG31954

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:281 Identity:88/281 - (31%)
Similarity:147/281 - (52%) Gaps:29/281 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLI--SVLVILSQCSAKSVKIHRRHQLNHHLGH---VKP--ETRVIGGVDSPTGFAPYQVS 58
            ::..||:  |:||:...|.... .:.|:..|...:.:   :.|  :.|::||.......||:|||
  Fly     4 LRLFVLLQCSLLVLAGVCLIPQ-PVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVS 67

  Fly    59 IMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQY------LKIVTGTVDYTRPGAEYLVDGSKIHC 117
            :..:  .|:||||||:.:||||||||     .|      ||:..||.::.|.|  .|:...|| .
  Fly    68 LQTS--SHICGGSIISEEWILTAAHC-----TYGKTADRLKVRLGTSEFARSG--QLLRVQKI-V 122

  Fly   118 SHDKPAYHN---DIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQL 179
            .|.:..|.|   |.:|:..|.||.:|:..:.:||.........|:...::|||:|:........|
  Fly   123 QHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWL 187

  Fly   180 QKIDLNYIDHDNCQSRVRNANWLSEGHVCT-FTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEAC 243
            :::::..::.:.|..:.:....::|..:|. |.:.|:.:|.||||||:|..:..|||||:||..|
  Fly   188 RQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGC 252

  Fly   244 A-IGYPDVFGSVAYYHDWIEQ 263
            | ..||.|:..|::..|||::
  Fly   253 AKPDYPGVYSRVSFARDWIKE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 77/230 (33%)
Tryp_SPc 42..263 CDD:238113 78/231 (34%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 77/230 (33%)
Tryp_SPc 51..274 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.