DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG1304

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:276 Identity:86/276 - (31%)
Similarity:131/276 - (47%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLI-SVLVILSQCSAKSVKIHRR-HQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTF 63
            :|..:|: |.|::|      :|.:|.. ..||         .||:||.|:.....|:|||:.|. 
  Fly     4 VKAAILLGSFLLLL------AVPVHSAPGSLN---------GRVVGGEDAVKNQFPHQVSLRNA- 52

  Fly    64 GEHVCGGSIIAPQWILTAAHCM--------EWPI--QYLKIVTGTVDYTRPGAEYLVDGSKIHCS 118
            |.|.|||||::..::||||||:        ..||  :...|..|:.|....|.  ||..:::...
  Fly    53 GSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGV--LVQVAEVIVH 115

  Fly   119 HDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKID 183
            .:...:.||:||:....|::.....|||.|.:..:...|  .:.::|||..|..|.....||...
  Fly   116 EEYGNFLNDVALLRLESPLILSASIQPIDLPTADTPADV--DVIISGWGRIKHQGDLPRYLQYNT 178

  Fly   184 LNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVN--WGEACAIG 246
            |..|..:.|...:   .|..:..:|...:...|:|:||||||.|..|| :|||..  | .||...
  Fly   179 LKSISLERCDELI---GWGVQSELCLIHEADNGACNGDSGGPAVYNNQ-VVGVAGFVW-SACGTS 238

  Fly   247 YPDVFGSVAYYHDWIE 262
            |||.:..|.|:::||:
  Fly   239 YPDGYARVYYHNEWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 75/231 (32%)
Tryp_SPc 42..263 CDD:238113 76/233 (33%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 75/231 (32%)
Tryp_SPc 32..256 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.