DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Prss34

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:304 Identity:76/304 - (25%)
Similarity:131/304 - (43%) Gaps:71/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIM-----NT 62
            ||.::.:|.:...|...::      .|...||..:....::||........|:|||:.     ::
Mouse     2 CLGMLWLLFLSLPCLGNTM------PLTLDLGSGQGLVGIVGGCPVSASRFPWQVSLRLYDMEHS 60

  Fly    63 FGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRP------GAEYLVDGSKIHCSHDK 121
            ..||.||||:|.|||:||||||:                 ||      |....|...::: .:|:
Mouse    61 RWEHECGGSLIHPQWVLTAAHCV-----------------RPKEVEAYGVRVQVGQLRLY-ENDQ 107

  Fly   122 ----------PAYHN--------DIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLT--LTGW 166
                      |.:..        ||||:.....:|..:...|:.|.: .|| ::..|.|  :.||
Mouse   108 LMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSLPA-ASL-RISSKKTCWVAGW 170

  Fly   167 GSTKTWGRYST--QLQKIDLNYIDHDNCQSRVR-------NANWLSEGHVCTFTQEGEGSCHGDS 222
            |..:.:.....  .|:::.:..:::::|:.:.:       ....:.:..:|. .:||..||..||
Mouse   171 GVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLCA-GKEGRDSCKADS 234

  Fly   223 GGPLV---DANQTLVGVVNWGEACAI-GYPDVFGSVAYYHDWIE 262
            |||||   :.:...||||:||..|.: .:|.|:..|..|..||:
Mouse   235 GGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYVSWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 67/263 (25%)
Tryp_SPc 42..263 CDD:238113 69/265 (26%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 68/263 (26%)
Tryp_SPc 35..277 CDD:214473 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.