DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and psh

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:270 Identity:79/270 - (29%)
Similarity:121/270 - (44%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KIHRRHQL---NHHLGHVKPETRVIGGVDSPTGFAPYQVSI-MNTFG-EHVCGGSIIAPQWILTA 81
            ||..|.|.   |..:.|      ::||.....|..|:..:| ..||| :..||||:||.:::|||
  Fly   127 KIRERKQQRSGNQLVIH------IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTA 185

  Fly    82 AHCMEWPIQYLKIV-TGTVDYTRPGAEY---LVDGSKIHCSHDKPAY----HNDIALIHTAKPIV 138
            |||:.........| .|.|:...|...|   ::...|||     |.|    :||||::...:.:|
  Fly   186 AHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKIH-----PQYVGNKYNDIAILELERDVV 245

  Fly   139 YDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQ-LQKIDLNYIDHDNCQ----SRVRN 198
            ..|..:|..|.:..:.|....|..:.|||......|..:: |.:..|..:..|.|.    .:..:
  Fly   246 ETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGS 310

  Fly   199 ANWLSEGHV----CTFTQE-GEGSCHGDSGGPLV------DANQTLVGVVNWGEACAIGYPDVFG 252
            ...|.:|.:    |...|: ...:|.|||||||:      |...|::||::.|..||...|.::.
  Fly   311 IRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYT 375

  Fly   253 SVAYYHDWIE 262
            .|:.|.|:||
  Fly   376 RVSSYLDFIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 71/245 (29%)
Tryp_SPc 42..263 CDD:238113 73/247 (30%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 72/251 (29%)
Tryp_SPc 144..387 CDD:238113 73/247 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437643
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.