DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Hayan

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:255 Identity:70/255 - (27%)
Similarity:120/255 - (47%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KPET-RVIGGVDSPTGFAPYQVSI-MNTFGEHV--CGGSIIAPQWILTAAHCM---EWPIQYLKI 94
            ||.| .::.|.....|..|:..:| .|:||...  ||||:||.:::||||||:   :....::::
  Fly   379 KPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRL 443

  Fly    95 VTGTVDYTRPGAEYL-VDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVG 158
            ....::...||.:.: |...:||..:...:.:.|||::..|:.....|:.:|..|.:..|.|...
  Fly   444 GALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPAN 508

  Fly   159 DKLTLTGWGSTKTWGR-YSTQLQKIDLNYIDHDNCQSRVRNANWLSE-------------GHVCT 209
            .|..:.|||......| .|..|.:..|:.:..|.|     ||::..:             ..:|.
  Fly   509 YKYFVAGWGVMNVTNRAVSKILLRAALDLVPADEC-----NASFAEQPSANRTLRRGVIASQLCA 568

  Fly   210 FTQ-EGEGSCHGDSGGPL------VDANQTLVGVVNWGEACAIGYPDVFGSVAYYHDWIE 262
            ..: :.:.:|.|||||||      ||...::|||::.|..||...|.::..|:.:.|:||
  Fly   569 ADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYIE 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 65/247 (26%)
Tryp_SPc 42..263 CDD:238113 67/249 (27%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 65/247 (26%)
Tryp_SPc 385..630 CDD:238113 67/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437644
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.