DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and sphe

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:269 Identity:78/269 - (28%)
Similarity:117/269 - (43%) Gaps:73/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTG 97
            :|....:.|::||.|:......:..| :.....|||||||::...|||.|||:.           
  Fly    17 VGMCHAQGRIMGGEDADATATTFTAS-LRVDNAHVCGGSILSQTKILTTAHCVH----------- 69

  Fly    98 TVDYTRPGAEYLVDGSKIHCS--------------------HDKPAYH---NDIALIHTAKPIVY 139
                 |.|.  |:|.|::.|.                    |  |.|:   |::|:|..:..:.|
  Fly    70 -----RDGK--LIDASRLACRVGSTNQYAGGKIVNVESVAVH--PDYYNLNNNLAVITLSSELTY 125

  Fly   140 DDLTQPIKLASKG-SLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLN----------YIDHDNCQ 193
            .|....|.|.:.| :||..|.::.:.|||.|.. |..|.::::|.|.          |.|||   
  Fly   126 TDRITAIPLVASGEALPAEGSEVIVAGWGRTSD-GTNSYKIRQISLKVAPEATCLDAYSDHD--- 186

  Fly   194 SRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNW--GEACAIGYPDVFGSVAY 256
                      |...|...:..||:||||.||..:..| ||:|:.|:  | ||...|||||..::.
  Fly   187 ----------EQSFCLAHELKEGTCHGDGGGGAIYGN-TLIGLTNFVVG-ACGSRYPDVFVRLSS 239

  Fly   257 YHDWIEQMM 265
            |.|||::.:
  Fly   240 YADWIQEQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 75/255 (29%)
Tryp_SPc 42..263 CDD:238113 76/256 (30%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 73/241 (30%)
Tryp_SPc 42..244 CDD:214473 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.