DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG31220

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:263 Identity:76/263 - (28%)
Similarity:118/263 - (44%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KPET--RVIGGVDSPTGFAPYQV-------SIMNTFGEHV--CGGSIIAPQWILTAAHCMEWPIQ 90
            ||:|  |||||.:......|:..       |..|...|.|  ||||:|..:::||||||:...:.
  Fly    97 KPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVL 161

  Fly    91 YLKIVTGTVDYTRPGAEYLVDGSKIHC-------------SHD--KPA---YHNDIALIHTAKPI 137
            .::.|......|....:.:..|::|.|             ||:  .||   :.|||||:...:|:
  Fly   162 QIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPV 226

  Fly   138 VYDDLTQPI-KLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANW 201
            .|.....|| .|....||.|.  |:.:.|||.|..:...|..|:...:.....:.|..:..:.::
  Fly   227 RYTMAYYPICVLDYPRSLMKF--KMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRHF 289

  Fly   202 LSEGHVCTFTQEGEGSCHGDSGGPLVDAN----QT---LVGVVNWGEAC-AIGYPDVFGSVAYYH 258
            .....:|....:..|:|.||||.||:..:    :|   |.|:.::|..| .||:|.||...|.::
  Fly   290 GPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFY 354

  Fly   259 DWI 261
            .||
  Fly   355 KWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 71/255 (28%)
Tryp_SPc 42..263 CDD:238113 72/256 (28%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 71/255 (28%)
Tryp_SPc 104..360 CDD:238113 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.