DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and prss59.1

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:235 Identity:66/235 - (28%)
Similarity:122/235 - (51%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTR 103
            :.:::||.:......|:|.|:.:  |.|.||||:::..|:::||||.:..:: :::....: ...
Zfish    18 DDKIVGGYECQPNSQPWQASLNS--GYHFCGGSLVSEYWVVSAAHCYKSRVE-VRLGEHNI-VIN 78

  Fly   104 PGAEYLVDGSKI--HCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKL----ASKGSLPKVGDKLT 162
            .|.|..:...|:  :.::|.....:||.||..:||...:...||:.|    |:.|::.:|     
Zfish    79 EGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLSKPATLNKYVQPVALPNGCAADGTMCRV----- 138

  Fly   163 LTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCT-FTQEGEGSCHGDSGGPL 226
             :|||:|.:....|.:||.:::..:...:|.:..  ...:::...|. :.:.|:.||.||||||:
Zfish   139 -SGWGNTMSSTADSNKLQCLEIPILSDRDCNNSY--PGMITDTMFCAGYLEGGKDSCQGDSGGPV 200

  Fly   227 VDANQTLVGVVNWGEACA-IGYPDVFGSVAYYHDWIEQMM 265
            | .|..|.|:|:||..|| ..:|.|:|.|..:..||...|
Zfish   201 V-CNGELHGIVSWGYGCAEKNHPGVYGKVCMFSQWIADTM 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 63/227 (28%)
Tryp_SPc 42..263 CDD:238113 65/228 (29%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 63/227 (28%)
Tryp_SPc 21..238 CDD:238113 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.