DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG31681

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:281 Identity:83/281 - (29%)
Similarity:136/281 - (48%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CL-VLISVLVILS--QCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFG 64
            || :|:|:||.::  .|:|:.               ..||.|::||...|..:.|:|||:.|. .
  Fly     2 CLRLLLSILVSIAGLACAARI---------------PGPEERIVGGSYIPIEYVPWQVSVQNN-S 50

  Fly    65 EHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKI-----HCSHDK--P 122
            .|.|||.|.:.:.|||||||       |..||.|....|.|:.|...|.::     ..:|.|  |
  Fly    51 LHCCGGVIYSDRAILTAAHC-------LSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVP 108

  Fly   123 AYHN--DIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTK-----TWGRYSTQLQ 180
            ..:|  |||::....|:......:.|.||.:  .|..|..:..:|||.|:     .|    ..||
  Fly   109 KLYNPYDIAVLILEAPLRLGGTVKKIPLAEQ--TPVAGTIVLTSGWGYTRENSSFLW----PILQ 167

  Fly   181 KIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVD----ANQTLVGVVNWGE 241
            .:.:..::..:|....::.| ::...:|...|..: :|.|||||||::    .::.|:|:|:||:
  Fly   168 GVHVAILNRTDCLKAYKHVN-ITIDMICADGQRWD-TCQGDSGGPLIETTKGGHRQLIGMVSWGD 230

  Fly   242 ACAIGYPDVFGSVAYYHDWIE 262
            .|... |.|:..:|::|:||:
  Fly   231 GCGTN-PGVYEDIAFFHNWIK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 71/237 (30%)
Tryp_SPc 42..263 CDD:238113 72/239 (30%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 71/237 (30%)
Tryp_SPc 29..250 CDD:238113 71/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.