DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG31269

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:267 Identity:120/267 - (44%)
Similarity:163/267 - (61%) Gaps:8/267 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE 65
            |..:||:.:|.:....|..:::|    :.|...|....:.|:|||..:..||||||:|:....|.
  Fly     1 MSAVVLLILLGLSGLVSITAIRI----KGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGA 61

  Fly    66 HVCGGSIIAPQWILTAAHCMEWP-IQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIA 129
            |.|||:||...::||||||:|.. |.:|.:||||..|.:||..|.:....|||::|.|..|||||
  Fly    62 HSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIA 126

  Fly   130 LIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQS 194
            |:...:||.:|:.||||.|......|  ||::.|||||||..||.....||.:.|.|:.|..|::
  Fly   127 LLELVEPIAWDERTQPIPLPLVPMQP--GDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKA 189

  Fly   195 RVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACAIGYPDVFGSVAYYHD 259
            .:.|......||:|||::.|||:|||||||||| :|..|||:||||..||.|.|||..||.:|.|
  Fly   190 LLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV-SNGYLVGLVNWGWPCATGVPDVHASVYFYRD 253

  Fly   260 WIEQMMT 266
            ||..:|:
  Fly   254 WIRNVMS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 109/220 (50%)
Tryp_SPc 42..263 CDD:238113 110/221 (50%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 109/220 (50%)
Tryp_SPc 38..258 CDD:238113 110/222 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRU4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 1 1.000 - - mtm9682
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.