DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and sphinx1

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:276 Identity:65/276 - (23%)
Similarity:126/276 - (45%) Gaps:40/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIM----N 61
            ||.:|.:.||.:       :|.:..:::|:         .|:.||..:.|....|.|.|:    .
  Fly     1 MKLVVTLLVLSL-------TVSVGEKNKLS---------PRIAGGYRAKTFTIIYLVGIVYFKSQ 49

  Fly    62 TFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHN 126
            |...:...|:||:.|||||....:::  .|:::...:....| |.:.:    :|:..:.:..|.|
  Fly    50 TSSLNYGAGTIISNQWILTVKTVLKY--SYIEVHLASRRSYR-GFDII----RIYKENFRFHYDN 107

  Fly   127 D--IALIHTAKPIVYDDLTQPIKLASKGSLPK--VGDKLTLTGWGSTKTWGRYSTQLQKIDLNYI 187
            |  |||:..... .:|.....:::.:..:..:  ||:...:.|:|:.|...:....::.|::..:
  Fly   108 DHVIALVKCPYQ-KFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVM 171

  Fly   188 DHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV--DANQTLVGVVNW--GEACAIGYP 248
            ::..|........|.   .:||..:..:|.|.||.||.:|  ..|.|.:|:: |  .|.|:||||
  Fly   172 NNTECAKYYTPLKWY---EMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII-WLMPENCSIGYP 232

  Fly   249 DVFGSVAYYHDWIEQM 264
            .|...|:.:..||:::
  Fly   233 SVHIRVSDHIKWIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 56/231 (24%)
Tryp_SPc 42..263 CDD:238113 57/232 (25%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 56/231 (24%)
Tryp_SPc 26..248 CDD:304450 57/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.