DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and spirit

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:253 Identity:74/253 - (29%)
Similarity:122/253 - (48%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIGGVDSPTGFAPYQVSI--MNTFGEHV---CGGSIIAPQWILTAAHCMEW---PIQYLKIVTGT 98
            |:||:.:.....|:..::  .:.|.:.:   |||::||..::||||||.:.   |...:::....
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196

  Fly    99 VDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIH---TAKPIVYDDLTQPIKLASKGSLPKVGDK 160
            :..|. |.:..:....||..:.....:|||||:.   .|||        .:|.....:..:|.:.
  Fly   197 LTLTE-GEDISIRRVIIHPDYSASTAYNDIALLELETAAKP--------ELKPTCIWTQKEVTNT 252

  Fly   161 L-TLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEG----HVCTFTQEGE-GSCH 219
            | |..|:|.|...|..|.||.|:.|..:.::.||...:. :.|::|    .:|.....|| .:|.
  Fly   253 LVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQK-DQLAQGVLGTQMCAGDITGERDTCQ 316

  Fly   220 GDSGGPLVDANQTL---VGVVNWGEACAIGYPDVFGSVAYYHDWIE------QMMTDA 268
            |||||||:..:..|   ||:.:.|:.||.|.|.|:..|:.:.||||      |.:|:|
  Fly   317 GDSGGPLLMQDGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQQVTNA 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 68/238 (29%)
Tryp_SPc 42..263 CDD:238113 71/246 (29%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 71/241 (29%)
Tryp_SPc 132..361 CDD:214473 68/238 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.