DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Klk15

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:241 Identity:71/241 - (29%)
Similarity:111/241 - (46%) Gaps:32/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTR-P 104
            :|:.|.:......|:||::... |...||..:|:|:|:||||||.   .:::::..|..:..: .
Mouse    19 KVLEGEECVPHSQPWQVALFER-GRFNCGAFLISPRWVLTAAHCQ---TRFMRVRLGEHNLRKFD 79

  Fly   105 GAEYLVDGSKI--HCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWG 167
            |.|.|...|:|  |..::...:.:||.|:...||.......:|:.|..:  .|.:|:...::|||
Mouse    80 GPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAYVRPVALPRR--CPLIGEDCVVSGWG 142

  Fly   168 STKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGH-------------VCTFTQEGEG--S 217
            ........:|..||..:...|..:|    .|.:.:||..             ||... ||.|  |
Mouse   143 LLSDNNPGATGSQKSHVRLPDTLHC----ANISIISEASCNKDYPGRVLPTMVCAGV-EGGGTDS 202

  Fly   218 CHGDSGGPLVDANQTLVGVVNWGEA-C-AIGYPDVFGSVAYYHDWI 261
            |.|||||||| ....|.|:|:||:. | ....|.|:..|..|.:||
Mouse   203 CEGDSGGPLV-CGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 69/239 (29%)
Tryp_SPc 42..263 CDD:238113 71/240 (30%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.