DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG11664

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:236 Identity:54/236 - (22%)
Similarity:85/236 - (36%) Gaps:64/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IMNTFG-EHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRP-------GAEYL------ 109
            :|..:| :.:..||:.:.:::||.|||.:             ..|:|       |..::      
  Fly    37 VMQIYGPQFLAAGSLFSARYVLTVAHCFK-------------KNTKPEELSVRAGYRWIAWEFRG 88

  Fly   110 --VDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLP--KVGDKLTLTGWGSTK 170
              |.|...|.........||||::.....|.:..:...|.|.|:...|  .......|.||... 
  Fly    89 KQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNLM- 152

  Fly   171 TWGRYSTQLQKIDLNYIDHDNCQSRVRNANW---LSEGHVCTFTQEGEGSCHGDSGGPLVDANQT 232
               ..:..|:.:.:......||:      .|   :|.|.:|.....|||.|:||||.||:..   
  Fly   153 ---HIAQPLKSMSVQVEPEKNCR------QWFPQISGGVICASATMGEGLCYGDSGDPLISG--- 205

  Fly   233 LVGVVNWGEACAIG----------YPDVFGSVAYYHDWIEQ 263
                   ||.|.:.          ||.:|..|.|:..:|.|
  Fly   206 -------GEVCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 52/232 (22%)
Tryp_SPc 42..263 CDD:238113 53/234 (23%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 53/233 (23%)
Tryp_SPc 38..237 CDD:214473 52/231 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.