DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Elane

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:240 Identity:68/240 - (28%)
Similarity:107/240 - (44%) Gaps:34/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEW-PIQYLKIVTGTVDYTR 103
            :.::||..:.....|:.||:... |.|.||.::||..::::||||:.. ..|.:::|.|..|..|
  Rat    31 SEIVGGRPAQPHAWPFMVSLQRR-GGHFCGATLIARNFVMSAAHCVNGRNFQSVQVVLGAHDLRR 94

  Fly   104 --PGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGW 166
              |..:............|.....|||.:|........:...|..:|.::|.  .||::......
  Rat    95 REPTRQIFSVQRIFENGFDPSRLLNDIVIIQLNGSATINANVQVAELPAQGQ--GVGNRTPCVAM 157

  Fly   167 GSTKTWGRYSTQ------LQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGE-GSCHGDSGG 224
            |    |||..|.      ||::::..:. :.|:.||         :|||.....: |.|.|||||
  Rat   158 G----WGRLGTNRPLPSVLQELNVTVVT-NLCRRRV---------NVCTLVPRRQAGICFGDSGG 208

  Fly   225 PLVDANQTLVGV---VNWGEACAIG-YPDVFGSVAYYHDWIEQMM 265
            ||| .|..:.|:   :..|  |..| |||.|..||.:.|||..::
  Rat   209 PLV-CNNLVQGIDSFIRGG--CGSGFYPDAFAPVAEFADWINSII 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 66/233 (28%)
Tryp_SPc 42..263 CDD:238113 68/234 (29%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 66/233 (28%)
Tryp_SPc 33..249 CDD:238113 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.