DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Klk11

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:252 Identity:77/252 - (30%)
Similarity:123/252 - (48%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTG- 97
            |||..|||:|.|.:......|:||::... ...:||.::|||:|:||||||.:   .:..|:.| 
  Rat    43 GHVGGETRIIKGYECRPHSQPWQVALFQK-TRLLCGATLIAPKWLLTAAHCRK---PHYVILLGE 103

  Fly    98 ---------------TVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIK 147
                           |..:..||         .:.|.....:.|||.|:..:.|.......:|:.
  Rat   104 HNLEKTDGCEQRRMATESFPHPG---------FNNSLPNKDHRNDIMLVKMSSPAFITRAVRPLT 159

  Fly   148 LASKGSLPKVGDKLTLTGWGSTKT-WGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVC-TF 210
            |:|  .....|....::|||:|.: ..|....|:..:::.|.|..|: |....| :::..:| :.
  Rat   160 LSS--LCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECE-RAYPGN-ITDTMLCASV 220

  Fly   211 TQEGEGSCHGDSGGPLVDANQTLVGVVNWG-EACAI-GYPDVFGSVAYYHDWIEQMM 265
            .:||:.||.|||||||| .|.:|.|:::|| :.||: ..|.|:..|..|.|||.::|
  Rat   221 RKEGKDSCQGDSGGPLV-CNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDWIHEVM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 69/239 (29%)
Tryp_SPc 42..263 CDD:238113 70/240 (29%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 69/239 (29%)
Tryp_SPc 51..275 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.