DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Prss34

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:306 Identity:79/306 - (25%)
Similarity:127/306 - (41%) Gaps:79/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPET--------RVIGGVDSPTGFAPYQVSI 59
            ||.::..|.:...|                ||...|.|        .::||........|:|||:
  Rat     2 CLGMLWFLFLTLPC----------------LGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSL 50

  Fly    60 ------MNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKI--- 115
                  ::.: ||:||||:|.|||:||||||:|     ||.:..:....:.|...|.:..::   
  Rat    51 RFYNMKLSKW-EHICGGSLIHPQWVLTAAHCVE-----LKEMEASCFRVQVGQLRLYENDQLMKV 109

  Fly   116 -----HCSHDKPAYHN--------DIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLT--LTG 165
                 |     |.:..        ||||:.....:|..:...|:.|.:...  ::..|.|  :.|
  Rat   110 AKIIRH-----PKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQ--RISSKKTWWVAG 167

  Fly   166 WGSTKTWGRY----STQLQKIDLNYIDHDNCQSRVRNANWL-------SEGHVCTFTQEGEGSCH 219
            ||..:  |..    ...|:::.:..:.:.:|:.:.|..:.|       .:..:|. ..||..||.
  Rat   168 WGVIE--GHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCA-GMEGRDSCQ 229

  Fly   220 GDSGGPLV---DANQTLVGVVNWGEACAI-GYPDVFGSVAYYHDWI 261
            .|||||||   :.:...||||:||..|.: .:|.|:..|..|..||
  Rat   230 ADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 69/258 (27%)
Tryp_SPc 42..263 CDD:238113 71/259 (27%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 71/259 (27%)
Tryp_SPc 33..275 CDD:214473 69/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.