DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and KLK9

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:294 Identity:82/294 - (27%)
Similarity:130/294 - (44%) Gaps:75/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE 65
            ||..:|.::|.:|:                   ||...:||.||..:......|:|..:.     
Human     1 MKLGLLCALLSLLA-------------------GHGWADTRAIGAEECRPNSQPWQAGLF----- 41

  Fly    66 HV----CGGSIIAPQWILTAAHC----------------MEWPIQYLKIVTGTVDYTRPGAEYLV 110
            |:    ||.::|:.:|:||||||                .|.|.|..::   |..:..||.    
Human    42 HLTRLFCGATLISDRWLLTAAHCRKPYLWVRLGEHHLWKWEGPEQLFRV---TDFFPHPGF---- 99

  Fly   111 DGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKT-WGR 174
              :|...::|   :::||.||...:........||:.|:.....|  |.:..::|||:..: ...
Human   100 --NKDLSAND---HNDDIMLIRLPRQARLSPAVQPLNLSQTCVSP--GMQCLISGWGAVSSPKAL 157

  Fly   175 YSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHV-----CTFTQE-GEGSCHGDSGGPLVDANQTL 233
            :...||..:::.:::..|       :|...||:     |....| |.|||.|||||||| .|.||
Human   158 FPVTLQCANISILENKLC-------HWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLV-CNGTL 214

  Fly   234 VGVVNWG-EACA-IGYPDVFGSVAYYHDWIEQMM 265
            .|||:.| |.|: ...|.|:.||.:|.|||:::|
Human   215 AGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEIM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 71/248 (29%)
Tryp_SPc 42..263 CDD:238113 72/249 (29%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.