DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG33461

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:295 Identity:72/295 - (24%)
Similarity:130/295 - (44%) Gaps:48/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE 65
            ||.::....|.:|....:.||.:.....:...|.:     ::|.|..:..|..|: ::.::|...
  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSY-----KIINGTPARLGRYPW-MAFLHTPTY 64

  Fly    66 HVCGGSIIAPQWILTAAHCMEWPIQYL-----------------KIVTGTVDYTRPGAEYLVDGS 113
            .:|.||:|...::||:|||:|..::.:                 :.:..|       .||.||..
  Fly    65 FLCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEAT-------QEYNVDML 122

  Fly   114 KIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLT---LTGWGSTKT--WG 173
            ..|..:|...:.|||.::...:.:.|....|||.:.....:..|.|::|   .||||.|.|  ..
  Fly   123 FKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNT 187

  Fly   174 RYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGP-----LVDANQTL 233
            :.|..|.:::|.....::| :|:...|:|| |.:|....:| ..|.||||||     |:...:..
  Fly   188 KSSRVLMELNLYRRPRNDC-ARIFKQNFLS-GQICAGNDDG-NLCRGDSGGPQGRYVLIFGMKRF 249

  Fly   234 V--GVVNWG-EACAIGYPDVFGSVAYYHDWIEQMM 265
            |  |:.::. |.|:  ...:...|..|..||::::
  Fly   250 VQMGIASFTYENCS--KVSILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 63/249 (25%)
Tryp_SPc 42..263 CDD:238113 65/250 (26%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 63/249 (25%)
Tryp_SPc 42..281 CDD:238113 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.