DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Sp212

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:249 Identity:58/249 - (23%)
Similarity:118/249 - (47%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIGGVDSPTGFAPYQVSIMNTFGEHV------CGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVD 100
            ::.|.:.|.|..|:..::   :.:.|      |.||:|:...:::||||:....:. ::|.|...
  Fly   277 IVRGNEFPRGQYPWLSAV---YHKEVRALAFKCRGSLISSSIVISAAHCVHRMTED-RVVVGLGR 337

  Fly   101 YTRPGAEYLVDGSKI--------HCSHDKPAYHN-DIALIHTAKPIVYDDLTQPIKLASKGSLPK 156
            |...  :|..||:::        |..::..:|.: |||||...:|:.::|:..||.:.:..:...
  Fly   338 YDLD--DYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRT 400

  Fly   157 VGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANW----LSEGHVCTFTQEGEGS 217
            |.....:.|||..:...|  ||..::    ::.:.....|..:.|    ::|..:|...::|.|.
  Fly   401 VSTTGFIAGWGRDEDSSR--TQYPRV----VEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGP 459

  Fly   218 CHGDSGGPLV--DANQTLV-GVVNWGE-----ACAIGYPDVFGSVAYYHDWIEQ 263
            |.|||||.|:  ..::.|: |:|:.||     .|.:....::..::.:.:||.:
  Fly   460 CVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 56/245 (23%)
Tryp_SPc 42..263 CDD:238113 58/247 (23%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 58/249 (23%)
Tryp_SPc 277..511 CDD:214473 56/245 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.