DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Prss2

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:232 Identity:77/232 - (33%)
Similarity:123/232 - (53%) Gaps:14/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVD 100
            |..:.:::||........|||||:.:  |.|.||||:|..||:::||||.:..|| :::....::
  Rat    18 VDDDDKIVGGYTCQENSVPYQVSLNS--GYHFCGGSLINDQWVVSAAHCYKSRIQ-VRLGEHNIN 79

  Fly   101 YTRPGAEYLVDGSKI--HCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTL 163
            ... |.|..|:.:||  |.:.|:...:|||.||..:.|:..:.....:.|.|  |....|.:..:
  Rat    80 VLE-GNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPS--SCAPAGTQCLI 141

  Fly   164 TGWGSTKTWG-RYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCT-FTQEGEGSCHGDSGGPL 226
            :|||:|.:.| .....||.:|...:...:|::.....  :::..||. |.:.|:.||.||||||:
  Rat   142 SGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGK--ITDNMVCVGFLEGGKDSCQGDSGGPV 204

  Fly   227 VDANQTLVGVVNWGEACAI-GYPDVFGSVAYYHDWIE 262
            | .|..|.|:|:||..||: ..|.|:..|..|.|||:
  Rat   205 V-CNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 74/224 (33%)
Tryp_SPc 42..263 CDD:238113 76/226 (34%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 74/224 (33%)
Tryp_SPc 24..242 CDD:238113 76/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.