DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG30286

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:268 Identity:71/268 - (26%)
Similarity:111/268 - (41%) Gaps:68/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYL 92
            |...|..|:.         :||      .::.::..||.||||:::..::|||||||:. ..:.|
  Fly    35 QNEEHQAHIS---------ESP------WMAYLHKSGELVCGGTLVNHRFILTAAHCIR-EDENL 83

  Fly    93 KIVTGTV-----------DYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPI 146
            .:..|..           |...|..::.:|.:..|..:.:....:||.|:..||.:.|....:||
  Fly    84 TVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPI 148

  Fly   147 KLASKGSL-PKVG--DKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVC 208
            .|.:..:| ||:.  .:|..||||.:.:             ...:|.....||...||    .||
  Fly   149 CLITNTTLQPKIERLHRLVATGWGRSPS-------------EAANHILKSIRVTRVNW----GVC 196

  Fly   209 TFT-------------QEGEGSCHGDSGGPLVDANQ-------TLVGVVNWGEACAIGYPDVFGS 253
            :.|             .|...||.||||||:..|.:       ..||:|::|.|..:. |.||.:
  Fly   197 SKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLS-PSVFTN 260

  Fly   254 VAYYHDWI 261
            |..:.|||
  Fly   261 VMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 66/253 (26%)
Tryp_SPc 42..263 CDD:238113 68/254 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 70/264 (27%)
Tryp_SPc 39..268 CDD:214473 68/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.