DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG30098

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:290 Identity:76/290 - (26%)
Similarity:127/290 - (43%) Gaps:63/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLISVLVILSQCS--------AKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIM 60
            :||::.||||:..|        :|.:.:.|              .|||||.::..  .|:...::
  Fly     5 IVLLTFLVILTLGSYGYSQLLDSKCIALFR--------------IRVIGGQNARR--TPWMAYLI 53

  Fly    61 --NTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGS----KIHCSH 119
              |.|   .||||:||.:::||||||.:.. ..|.:..|..|.:|     ..||.    ::...:
  Fly    54 RDNRF---ACGGSLIAYRFVLTAAHCTKIN-DNLFVRLGEYDSSR-----TTDGQTRSYRVVSIY 109

  Fly   120 DKPAY----HNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKL---TLTGWGSTKTWGRYST 177
            ....|    ::|||::...:.:|||...:||.:.....|..:.:.:   ||||||....:.:..|
  Fly   110 RHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPT 174

  Fly   178 QLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVD----ANQTL---VG 235
            .||::.|..:.::.|     ....||   :|.:... :.:|.|||||||..    .::|:   .|
  Fly   175 TLQEMSLRRVRNEYC-----GVPSLS---ICCWNPV-QYACFGDSGGPLGSLVKYGHKTIYVQFG 230

  Fly   236 VVNWGEACAIGYPDVFGSVAYYHDWIEQMM 265
            |.|.......||......::|. .|:.|.:
  Fly   231 VTNSVTGNCDGYSSYLDLMSYM-PWLYQTL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 65/239 (27%)
Tryp_SPc 42..263 CDD:238113 65/240 (27%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 65/238 (27%)
Tryp_SPc 37..258 CDD:238113 65/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.