DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG30091

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:255 Identity:82/255 - (32%)
Similarity:125/255 - (49%) Gaps:37/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCM----EWPIQYLKI------- 94
            :::||||:.....|: ::::.|..|.:||||:|..:::|||||||    |..::|.::       
  Fly    36 KIVGGVDAGELKNPW-MALIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVY 99

  Fly    95 -VTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVG 158
             :..|.::..|...|.|:...||.|.....|.|||||:...|.|||....:|:.:.....|....
  Fly   100 HLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQT 164

  Fly   159 D---KLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGH--VCTFTQEGEGSC 218
            |   :.|..|||.|.. |:.|..||.:.:..||...|::    |.|.:..:  .|..|..|..:|
  Fly   165 DLIQEFTAIGWGVTGN-GKMSNNLQMVKIYRIDRKMCEA----AFWYTFDYPMFCAGTAVGRDTC 224

  Fly   219 HGDSGGP-----LVDA--NQTLVGVVNWG-EAC-AIG-YPDVFGSVAYYHDWIEQMMTDA 268
            ..|||||     |.|.  ..|.:|:|:.| |.| ..| |.||.|.:    |:||:::.||
  Fly   225 KRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHI----DFIERIVLDA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 78/246 (32%)
Tryp_SPc 42..263 CDD:238113 79/247 (32%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 78/246 (32%)
Tryp_SPc 37..276 CDD:238113 80/248 (32%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.