DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG30090

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:251 Identity:77/251 - (30%)
Similarity:112/251 - (44%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTR-- 103
            ::|||.|:.....|:...|.::. :.:|||::|..:::||||||:. ....:|:..|..|.|.  
  Fly    39 KIIGGRDAIINSNPWMAYIHSSV-KLICGGTLITQRFVLTAAHCVN-EGSAVKVRLGEYDDTATE 101

  Fly   104 --------PGA-EYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKL---ASKGSLPK 156
                    |.| |:.||.:..|....:....|||||:..||.:.:.....||.:   .||..|..
  Fly   102 DCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVD 166

  Fly   157 VGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQ---SRVRNANWLSEGHVCTFTQEGEGSC 218
            ..:....||||.|:| .|....||...|...:...|.   .|:...|.:..|.:      |..:|
  Fly   167 SIEWFVATGWGETRT-HRTRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRL------GSDTC 224

  Fly   219 HGDSGGPLVDANQTL----------VGVVNWG--EACAIG-YPDVFGSVAYYHDWI 261
            :|||||||.   ||:          .|||::|  |...|| |.||:.    |.|||
  Fly   225 NGDSGGPLF---QTVRHMDKMRPVQFGVVSYGSRECSGIGVYTDVYS----YADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 75/249 (30%)
Tryp_SPc 42..263 CDD:238113 77/250 (31%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 75/249 (30%)
Tryp_SPc 40..276 CDD:238113 77/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.