DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG30083

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:254 Identity:65/254 - (25%)
Similarity:118/254 - (46%) Gaps:40/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LNHHLGHVKPETRVIGGVDSPTGFAPYQVSIM----NTFGEHVCGGSIIAPQWILTAAHCMEWPI 89
            |..:.|:.....:::.|.::..|..|:...|.    ....|.||||::|..|::|:||||::.. 
  Fly    21 LEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRD- 84

  Fly    90 QYLKIVTGTVDYTRPGA-------EYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIK 147
            |.|.:..|....:|..|       :|...||          |.|||.::.....:.::.:.:||.
  Fly    85 QILAVRLGEHSSSRYFAVTKAFRNKYFTTGS----------YSNDIGILRIQPIVKFNAVIRPIC 139

  Fly   148 LASKGS-LPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANW--LSEGHVCT 209
            :.:..: :|.| ......|||.|:. ..:|..|:.::||.::...|.    |..|  ::|..:|.
  Fly   140 IITDPTKVPNV-KTFKAAGWGKTEN-ETFSKVLKTVELNELNASECY----NMLWVNVTESQICA 198

  Fly   210 FTQEGEGSCHGDSGGPLV-----DANQTLV--GVVNWGEACAIGYPDVFGSVAYYHDWI 261
            ...:|: :|.|||||||:     |.:...|  |::::|.:.. ..|.|:..::.:.|||
  Fly   199 GHPDGD-TCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC-NSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 61/240 (25%)
Tryp_SPc 42..263 CDD:238113 63/241 (26%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 61/240 (25%)
Tryp_SPc 34..255 CDD:238113 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.