DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG30031

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:130/273 - (47%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPE-------TRVIGGVDSPTGFAPYQVS 58
            :|.::|:|.:.    |:               ||...||       .|::||..:.....|:|:|
  Fly     2 LKFVILLSAVA----CA---------------LGGTVPEGLLPQLDGRIVGGSATTISSFPWQIS 47

  Fly    59 IMNTFGEHVCGGSIIAPQWILTAAHCME-WPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKP 122
            :..: |.|.|||||.:...|:|||||:: .....|:|..|:..::..|..:.|...|.|..::..
  Fly    48 LQRS-GSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNAN 111

  Fly   123 AYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYS--TQLQKIDLN 185
            ...||||:|.....:.:....:.|.|||  |.|..|...:::||| |.::|..|  :|||.:::|
  Fly   112 TMVNDIAIIKINGALTFSSTIKAIGLAS--SNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVN 173

  Fly   186 YIDHDNCQSRVRN-ANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACAI-GYP 248
            .:....|.|.... .:.:....:|. ...|:.:|.||||||||... .|||||:||..||. .||
  Fly   174 IVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVSGG-VLVGVVSWGYGCAYSNYP 236

  Fly   249 DVFGSVAYYHDWI 261
            .|:..||....|:
  Fly   237 GVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 75/224 (33%)
Tryp_SPc 42..263 CDD:238113 75/225 (33%)
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 75/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.